![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families) ![]() contains additional, fifth helix at the N-terminus |
![]() | Family a.24.10.2: Phosphorelay protein-like [47230] (3 proteins) |
![]() | Protein Histidine-containing phosphotransfer protein HP2 [140411] (1 species) |
![]() | Species Maize (Zea mays) [TaxId:4577] [140412] (1 PDB entry) Uniprot Q9SLX1 9-139 |
![]() | Domain d1wn0b_: 1wn0 B: [121071] automated match to d1wn0a1 |
PDB Entry: 1wn0 (more details), 2.2 Å
SCOPe Domain Sequences for d1wn0b_:
Sequence, based on SEQRES records: (download)
>d1wn0b_ a.24.10.2 (B:) Histidine-containing phosphotransfer protein HP2 {Maize (Zea mays) [TaxId: 4577]} nallssmfasglvdeqfqqlqmlqedggtpgfvaevvtlfcddadriiselaalldqpiv dfdkvdayvhqlkgssasvgaqkvkftcmqfrqlcqdknrdgcimalavvrnefydlrnk fqtmlqle
>d1wn0b_ a.24.10.2 (B:) Histidine-containing phosphotransfer protein HP2 {Maize (Zea mays) [TaxId: 4577]} nallssmfasglvdeqfqqlqmlqtpgfvaevvtlfcddadriiselaalldqpivdfdk vdayvhqlkgssasvgaqkvkftcmqfrqlcqdknrdgcimalavvrnefydlrnkfqtm lqle
Timeline for d1wn0b_: