Lineage for d1wlza1 (1wlz A:229-311)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1994319Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1994320Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1995442Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 protein domains)
  6. 1995466Protein DJ-1-binding protein, DJBP [140536] (1 species)
  7. 1995467Species Human (Homo sapiens) [TaxId:9606] [140537] (1 PDB entry)
    Uniprot Q5THR3 1160-1242
  8. 1995468Domain d1wlza1: 1wlz A:229-311 [121024]
    Other proteins in same PDB: d1wlza2, d1wlzb2, d1wlzb3, d1wlzc_, d1wlzd_
    5th EF-hand module

Details for d1wlza1

PDB Entry: 1wlz (more details), 1.6 Å

PDB Description: Crystal structure of DJBP fragment which was obtained by limited proteolysis
PDB Compounds: (A:) CAP-binding protein complex interacting protein 1 isoform a

SCOPe Domain Sequences for d1wlza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]}
atadrdilarlhkavtshyhaitqefenfdtmktntisreefraicnrrvqiltdeqfdr
lwnempvnakgrlkypdflsrfs

SCOPe Domain Coordinates for d1wlza1:

Click to download the PDB-style file with coordinates for d1wlza1.
(The format of our PDB-style files is described here.)

Timeline for d1wlza1: