![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 proteins) |
![]() | Protein DJ-1-binding protein, DJBP [140536] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [140537] (1 PDB entry) Uniprot Q5THR3 1160-1242 |
![]() | Domain d1wlza1: 1wlz A:229-311 [121024] Other proteins in same PDB: d1wlza2, d1wlzb2, d1wlzb3, d1wlzc_, d1wlzd_ 5th EF-hand module |
PDB Entry: 1wlz (more details), 1.6 Å
SCOPe Domain Sequences for d1wlza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} atadrdilarlhkavtshyhaitqefenfdtmktntisreefraicnrrvqiltdeqfdr lwnempvnakgrlkypdflsrfs
Timeline for d1wlza1:
![]() Domains from other chains: (mouse over for more information) d1wlzb2, d1wlzb3, d1wlzc_, d1wlzd_ |