SCOPe 2.07: Domain d1wlza1: 1wlz A:229-311

Lineage for d1wlza1 (1wlz A:229-311)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 proteins)

6. Protein DJ-1-binding protein, DJBP [140536] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140537] (1 PDB entry)
   Uniprot Q5THR3 1160-1242

8. Domain d1wlza1: 1wlz A:229-311 [121024]
   Other proteins in same PDB: d1wlza2, d1wlzb2, d1wlzb3, d1wlzc_, d1wlzd_
   5th EF-hand module

Details for d1wlza1

PDB Entry: 1wlz, 1.6 Å

PDB Description: Crystal structure of DJBP fragment which was obtained by limited proteolysis

PDB Compounds: (A:) CAP-binding protein complex interacting protein 1 isoform a

SCOPe Domain Sequences for d1wlza1:

Sequence; same for both SEQRES and ATOM records:

>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]}
atadrdilarlhkavtshyhaitqefenfdtmktntisreefraicnrrvqiltdeqfdr
lwnempvnakgrlkypdflsrfs

Timeline for d1wlza1:

• d1wlza1 first appeared in SCOP 1.73
  
• d1wlza1 appears in SCOPe 2.06
  
• d1wlza1 appears in the current release, SCOPe 2.08