Lineage for d1wlzd_ (1wlz D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711389Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 proteins)
  6. 2711457Protein automated matches [190808] (1 species)
    not a true protein
  7. 2711458Species Human (Homo sapiens) [TaxId:9606] [188079] (3 PDB entries)
  8. 2711461Domain d1wlzd_: 1wlz D: [121027]
    Other proteins in same PDB: d1wlza1, d1wlza2, d1wlzb3
    automated match to d1wlza1

Details for d1wlzd_

PDB Entry: 1wlz (more details), 1.6 Å

PDB Description: Crystal structure of DJBP fragment which was obtained by limited proteolysis
PDB Compounds: (D:) CAP-binding protein complex interacting protein 1 isoform a

SCOPe Domain Sequences for d1wlzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wlzd_ a.39.1.7 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atadrdilarlhkavtshyhaitqefenfdtmktntisreefraicnrrvqiltdeqfdr
lwnempvnakgrlkypdflsrfs

SCOPe Domain Coordinates for d1wlzd_:

Click to download the PDB-style file with coordinates for d1wlzd_.
(The format of our PDB-style files is described here.)

Timeline for d1wlzd_: