SCOPe 2.08: Domain d1wlzb2: 1wlz B:229-310

Lineage for d1wlzb2 (1wlz B:229-310)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 proteins)

6. Protein automated matches [190808] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188079] (3 PDB entries)

8. Domain d1wlzb2: 1wlz B:229-310 [121025]
   Other proteins in same PDB: d1wlza1, d1wlza2, d1wlzb3
   automated match to d1wlza1

Details for d1wlzb2

PDB Entry: 1wlz, 1.6 Å

PDB Description: Crystal structure of DJBP fragment which was obtained by limited proteolysis

PDB Compounds: (B:) CAP-binding protein complex interacting protein 1 isoform a

SCOPe Domain Sequences for d1wlzb2:

Sequence; same for both SEQRES and ATOM records:

>d1wlzb2 a.39.1.7 (B:229-310) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atadrdilarlhkavtshyhaitqefenfdtmktntisreefraicnrrvqiltdeqfdr
lwnempvnakgrlkypdflsrf

Timeline for d1wlzb2:

• d1wlzb2 first appeared in SCOP 1.73, called d1wlzb1
  
• d1wlzb2 appears in SCOPe 2.07