Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) |
Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins) |
Protein automated matches [190102] (7 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [186824] (5 PDB entries) |
Domain d1wlvf_: 1wlv F: [121021] automated match to d1j1ya_ complexed with act, cl, coa |
PDB Entry: 1wlv (more details), 1.9 Å
SCOPe Domain Sequences for d1wlvf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wlvf_ d.38.1.5 (F:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} dpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgpav alscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl
Timeline for d1wlvf_: