Lineage for d1wlvg_ (1wlv G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943854Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 2943965Protein automated matches [190102] (7 species)
    not a true protein
  7. 2944023Species Thermus thermophilus HB8 [TaxId:300852] [186824] (5 PDB entries)
  8. 2944033Domain d1wlvg_: 1wlv G: [121022]
    automated match to d1j1ya_
    complexed with act, cl, coa

Details for d1wlvg_

PDB Entry: 1wlv (more details), 1.9 Å

PDB Description: Crystal structure of TT0310 protein from Thermus thermophilus HB8
PDB Compounds: (G:) Phenylacetic acid degradation protein paaI

SCOPe Domain Sequences for d1wlvg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wlvg_ d.38.1.5 (G:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
dpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgpav
alscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl

SCOPe Domain Coordinates for d1wlvg_:

Click to download the PDB-style file with coordinates for d1wlvg_.
(The format of our PDB-style files is described here.)

Timeline for d1wlvg_: