Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) |
Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins) |
Protein Phenylacetic acid degradation protein PaaI [89903] (2 species) |
Species Thermus thermophilus [TaxId:274] [102909] (1 PDB entry) |
Domain d1j1ya_: 1j1y A: [90776] complexed with cl, mg |
PDB Entry: 1j1y (more details), 1.7 Å
SCOPe Domain Sequences for d1j1ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j1ya_ d.38.1.5 (A:) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]} rdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgpa valscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl
Timeline for d1j1ya_: