Lineage for d1j1ya_ (1j1y A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 410666Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 410667Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (5 families) (S)
  5. 410746Family d.38.1.5: PaaI/YdiI-like [89902] (6 proteins)
  6. 410784Protein Phenylacetic acid degradation protein PaaI [89903] (2 species)
  7. 410788Species Thermus thermophilus [TaxId:274] [102909] (1 PDB entry)
  8. 410789Domain d1j1ya_: 1j1y A: [90776]

Details for d1j1ya_

PDB Entry: 1j1y (more details), 1.7 Å

PDB Description: Crystal Structure of PaaI from Thermus thermophilus HB8

SCOP Domain Sequences for d1j1ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j1ya_ d.38.1.5 (A:) Phenylacetic acid degradation protein PaaI {Thermus thermophilus}
rdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgpa
valscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl

SCOP Domain Coordinates for d1j1ya_:

Click to download the PDB-style file with coordinates for d1j1ya_.
(The format of our PDB-style files is described here.)

Timeline for d1j1ya_: