PDB entry 1j1y

View 1j1y on RCSB PDB site
Description: Crystal Structure of PaaI from Thermus thermophilus HB8
Class: hydrolase
Keywords: THIOESTERASE, HOT DOG FOLD, PHENYLACETIC ACID DEGRADATION, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, HYDROLASE
Deposited on 2002-12-24, released 2004-02-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.181
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PaaI protein
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1j1ya_
  • Chain 'B':
    Compound: PaaI protein
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1j1yb_
  • Heterogens: CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j1yA (A:)
    mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgp
    avalscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrlggd
    gddvpagtgnlaprea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j1yA (A:)
    rdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgpa
    valscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j1yB (B:)
    mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgp
    avalscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrlggd
    gddvpagtgnlaprea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j1yB (B:)
    dpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgpav
    alscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl