PDB entry 1wlv

View 1wlv on RCSB PDB site
Description: Crystal structure of TT0310 protein from Thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: Thioesterase, Hot dog fold, Phenylacetic acid degradation, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-06-29, released 2005-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.17
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phenylacetic acid degradation protein paaI
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wlva_
  • Chain 'B':
    Compound: Phenylacetic acid degradation protein paaI
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wlvb_
  • Chain 'C':
    Compound: Phenylacetic acid degradation protein paaI
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wlvc_
  • Chain 'D':
    Compound: Phenylacetic acid degradation protein paaI
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wlvd_
  • Chain 'E':
    Compound: Phenylacetic acid degradation protein paaI
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wlve_
  • Chain 'F':
    Compound: Phenylacetic acid degradation protein paaI
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wlvf_
  • Chain 'G':
    Compound: Phenylacetic acid degradation protein paaI
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wlvg_
  • Chain 'H':
    Compound: Phenylacetic acid degradation protein paaI
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wlvh_
  • Heterogens: CL, ACT, COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wlvA (A:)
    mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgp
    avalscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrlggd
    gddvpagtgnlaprea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wlvA (A:)
    mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgp
    avalscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wlvB (B:)
    mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgp
    avalscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrlggd
    gddvpagtgnlaprea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wlvB (B:)
    rdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgpa
    valscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wlvC (C:)
    mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgp
    avalscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrlggd
    gddvpagtgnlaprea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wlvC (C:)
    dpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgpav
    alscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wlvD (D:)
    mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgp
    avalscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrlggd
    gddvpagtgnlaprea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wlvD (D:)
    dpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgpav
    alscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1wlvE (E:)
    mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgp
    avalscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrlggd
    gddvpagtgnlaprea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wlvE (E:)
    dpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgpav
    alscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1wlvF (F:)
    mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgp
    avalscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrlggd
    gddvpagtgnlaprea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wlvF (F:)
    dpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgpav
    alscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1wlvG (G:)
    mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgp
    avalscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrlggd
    gddvpagtgnlaprea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wlvG (G:)
    dpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgpav
    alscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1wlvH (H:)
    mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgp
    avalscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrlggd
    gddvpagtgnlaprea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wlvH (H:)
    mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgp
    avalscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl