Lineage for d1wlva_ (1wlv A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. Protein automated matches [190102] (7 species)
    not a true protein
  7. Species Thermus thermophilus HB8 [TaxId:300852] [186824] (5 PDB entries)
  8. Domain d1wlva_: 1wlv A: [121016]
    automated match to d1j1ya_
    complexed with act, cl, coa

Details for d1wlva_

PDB Entry: 1wlv (more details), 1.9 Å

PDB Description: Crystal structure of TT0310 protein from Thermus thermophilus HB8
PDB Compounds: (A:) Phenylacetic acid degradation protein paaI

SCOPe Domain Sequences for d1wlva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wlva_ d.38.1.5 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgp
avalscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl

SCOPe Domain Coordinates for d1wlva_ are not available.

Timeline for d1wlva_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wlvb_, d1wlvc_, d1wlvd_, d1wlve_, d1wlvf_, d1wlvg_, d1wlvh_