| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.3: L30e-like [55315] (3 families) ![]() |
| Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins) |
| Protein Ribosomal protein L7ae [55319] (4 species) |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [55320] (40 PDB entries) |
| Domain d1vq9f1: 1vq9 F:1-119 [120223] Other proteins in same PDB: d1vq911, d1vq931, d1vq9a1, d1vq9a2, d1vq9b1, d1vq9c1, d1vq9d1, d1vq9e1, d1vq9e2, d1vq9h1, d1vq9i1, d1vq9j1, d1vq9k1, d1vq9l1, d1vq9m1, d1vq9n1, d1vq9o1, d1vq9p1, d1vq9q1, d1vq9r1, d1vq9s1, d1vq9t1, d1vq9u1, d1vq9v1, d1vq9w1, d1vq9x1, d1vq9y1, d1vq9z1 automatically matched to d1s72f_ complexed with 1ma, aca, cd, cl, k, mg, na, omg, omu, psu, sps, sr, ur3 |
PDB Entry: 1vq9 (more details), 2.4 Å
SCOP Domain Sequences for d1vq9f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vq9f1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdageadadvediadkveelr
Timeline for d1vq9f1:
View in 3DDomains from other chains: (mouse over for more information) d1vq911, d1vq931, d1vq9a1, d1vq9a2, d1vq9b1, d1vq9c1, d1vq9d1, d1vq9e1, d1vq9e2, d1vq9h1, d1vq9i1, d1vq9j1, d1vq9k1, d1vq9l1, d1vq9m1, d1vq9n1, d1vq9o1, d1vq9p1, d1vq9q1, d1vq9r1, d1vq9s1, d1vq9t1, d1vq9u1, d1vq9v1, d1vq9w1, d1vq9x1, d1vq9y1, d1vq9z1 |