Lineage for d1vq9k1 (1vq9 K:1-132)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667238Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 667239Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
  5. 667240Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 667241Protein Ribosomal protein L14 [50195] (3 species)
  7. 667242Species Archaeon Haloarcula marismortui [TaxId:2238] [50197] (40 PDB entries)
  8. 667272Domain d1vq9k1: 1vq9 K:1-132 [120227]
    Other proteins in same PDB: d1vq911, d1vq931, d1vq9a1, d1vq9a2, d1vq9b1, d1vq9c1, d1vq9d1, d1vq9e1, d1vq9e2, d1vq9f1, d1vq9h1, d1vq9i1, d1vq9j1, d1vq9l1, d1vq9m1, d1vq9n1, d1vq9o1, d1vq9p1, d1vq9q1, d1vq9r1, d1vq9s1, d1vq9t1, d1vq9u1, d1vq9v1, d1vq9w1, d1vq9x1, d1vq9y1, d1vq9z1
    automatically matched to d1s72k_
    complexed with 1ma, aca, cd, cl, k, mg, na, omg, omu, psu, sps, sr, ur3

Details for d1vq9k1

PDB Entry: 1vq9 (more details), 2.4 Å

PDB Description: the structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (K:) 50S ribosomal protein L14P

SCOP Domain Sequences for d1vq9k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq9k1 b.39.1.1 (K:1-132) Ribosomal protein L14 {Archaeon Haloarcula marismortui [TaxId: 2238]}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrlpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

SCOP Domain Coordinates for d1vq9k1:

Click to download the PDB-style file with coordinates for d1vq9k1.
(The format of our PDB-style files is described here.)

Timeline for d1vq9k1: