Lineage for d1vq9o1 (1vq9 O:1-115)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 690462Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 690463Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 690464Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 690517Protein Ribosomal protein L18e [52084] (1 species)
  7. 690518Species Archaeon Haloarcula marismortui [TaxId:2238] [52085] (40 PDB entries)
  8. 690548Domain d1vq9o1: 1vq9 O:1-115 [120231]
    Other proteins in same PDB: d1vq911, d1vq931, d1vq9a1, d1vq9a2, d1vq9b1, d1vq9c1, d1vq9d1, d1vq9e1, d1vq9e2, d1vq9f1, d1vq9h1, d1vq9i1, d1vq9j1, d1vq9k1, d1vq9l1, d1vq9m1, d1vq9n1, d1vq9p1, d1vq9q1, d1vq9r1, d1vq9s1, d1vq9t1, d1vq9u1, d1vq9v1, d1vq9w1, d1vq9x1, d1vq9y1, d1vq9z1
    automatically matched to d1ffkl_
    complexed with 1ma, aca, cd, cl, k, mg, na, omg, omu, psu, sps, sr, ur3

Details for d1vq9o1

PDB Entry: 1vq9 (more details), 2.4 Å

PDB Description: the structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (O:) 50S ribosomal protein L18e

SCOP Domain Sequences for d1vq9o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq9o1 c.12.1.1 (O:1-115) Ribosomal protein L18e {Archaeon Haloarcula marismortui [TaxId: 2238]}
sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir

SCOP Domain Coordinates for d1vq9o1:

Click to download the PDB-style file with coordinates for d1vq9o1.
(The format of our PDB-style files is described here.)

Timeline for d1vq9o1: