Lineage for d1vq9e1 (1vq9 E:1-79)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734251Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 734252Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 734253Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 734254Protein Ribosomal protein L6 [56055] (2 species)
    duplication: consists of two domains of this fold
  7. 734255Species Archaeon Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries)
  8. 734314Domain d1vq9e1: 1vq9 E:1-79 [120221]
    Other proteins in same PDB: d1vq911, d1vq931, d1vq9a1, d1vq9a2, d1vq9b1, d1vq9c1, d1vq9d1, d1vq9f1, d1vq9h1, d1vq9i1, d1vq9j1, d1vq9k1, d1vq9l1, d1vq9m1, d1vq9n1, d1vq9o1, d1vq9p1, d1vq9q1, d1vq9r1, d1vq9s1, d1vq9t1, d1vq9u1, d1vq9v1, d1vq9w1, d1vq9x1, d1vq9y1, d1vq9z1
    automatically matched to d1ffk11
    complexed with 1ma, aca, cd, cl, k, mg, na, omg, omu, psu, sps, sr, ur3

Details for d1vq9e1

PDB Entry: 1vq9 (more details), 2.4 Å

PDB Description: the structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (E:) 50S ribosomal protein L6P

SCOP Domain Sequences for d1vq9e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq9e1 d.141.1.1 (E:1-79) Ribosomal protein L6 {Archaeon Haloarcula marismortui [TaxId: 2238]}
prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
tigtfqshienmfhgvteg

SCOP Domain Coordinates for d1vq9e1:

Click to download the PDB-style file with coordinates for d1vq9e1.
(The format of our PDB-style files is described here.)

Timeline for d1vq9e1: