Lineage for d1vq9r1 (1vq9 R:1-150)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723129Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
    beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation
  4. 723130Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
    some topological similarity to prokaryotic ribosomal protein L17
  5. 723131Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 723132Protein Ribosomal protein L22 [54845] (2 species)
  7. 723133Species Archaeon Haloarcula marismortui [TaxId:2238] [54847] (39 PDB entries)
  8. 723163Domain d1vq9r1: 1vq9 R:1-150 [120234]
    Other proteins in same PDB: d1vq911, d1vq931, d1vq9a1, d1vq9a2, d1vq9b1, d1vq9c1, d1vq9d1, d1vq9e1, d1vq9e2, d1vq9f1, d1vq9h1, d1vq9i1, d1vq9j1, d1vq9k1, d1vq9l1, d1vq9m1, d1vq9n1, d1vq9o1, d1vq9p1, d1vq9q1, d1vq9s1, d1vq9t1, d1vq9u1, d1vq9v1, d1vq9w1, d1vq9x1, d1vq9y1, d1vq9z1
    automatically matched to d1ffko_
    complexed with 1ma, aca, cd, cl, k, mg, na, omg, omu, psu, sps, sr, ur3

Details for d1vq9r1

PDB Entry: 1vq9 (more details), 2.4 Å

PDB Description: the structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (R:) 50S ribosomal protein L22P

SCOP Domain Sequences for d1vq9r1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq9r1 d.55.1.1 (R:1-150) Ribosomal protein L22 {Archaeon Haloarcula marismortui [TaxId: 2238]}
gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
eqqgrkpramgrasawnspqvdvelileep

SCOP Domain Coordinates for d1vq9r1:

Click to download the PDB-style file with coordinates for d1vq9r1.
(The format of our PDB-style files is described here.)

Timeline for d1vq9r1: