Lineage for d1s72f_ (1s72 F:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727288Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 727493Superfamily d.79.3: L30e-like [55315] (3 families) (S)
  5. 727494Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins)
  6. 727506Protein Ribosomal protein L7ae [55319] (4 species)
  7. 727510Species Archaeon Haloarcula marismortui [TaxId:2238] [55320] (40 PDB entries)
  8. 727526Domain d1s72f_: 1s72 F: [105325]
    Other proteins in same PDB: d1s721_, d1s722_, d1s723_, d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3

Details for d1s72f_

PDB Entry: 1s72 (more details), 2.4 Å

PDB Description: refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
PDB Compounds: (F:) 50S ribosomal protein L7Ae

SCOP Domain Sequences for d1s72f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s72f_ d.79.3.1 (F:) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdageadadvediadkveelr

SCOP Domain Coordinates for d1s72f_:

Click to download the PDB-style file with coordinates for d1s72f_.
(The format of our PDB-style files is described here.)

Timeline for d1s72f_: