SCOP 1.73: Domain d1vq9c1: 1vq9 C:1-246

Lineage for d1vq9c1 (1vq9 C:1-246)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.22: Ribosomal protein L4 [52165] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family)

5. Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein)

6. Protein Ribosomal protein L4 [52168] (2 species)
   synonym: 50S ribosomal protein L4e, HMAL4, HL6

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [52170] (44 PDB entries)

8. Domain d1vq9c1: 1vq9 C:1-246 [120219]
   Other proteins in same PDB: d1vq911, d1vq931, d1vq9a1, d1vq9a2, d1vq9b1, d1vq9d1, d1vq9e1, d1vq9e2, d1vq9f1, d1vq9h1, d1vq9i1, d1vq9j1, d1vq9k1, d1vq9l1, d1vq9m1, d1vq9n1, d1vq9o1, d1vq9p1, d1vq9q1, d1vq9r1, d1vq9s1, d1vq9t1, d1vq9u1, d1vq9v1, d1vq9w1, d1vq9x1, d1vq9y1, d1vq9z1
   automatically matched to d1jj2c_
   complexed with 1ma, aca, cd, cl, k, mg, na, omg, omu, psu, sps, sr, ur3

Details for d1vq9c1

PDB Entry: 1vq9, 2.4 Å

PDB Description: the structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (C:) 50S ribosomal protein L4E

SCOP Domain Sequences for d1vq9c1:

Sequence; same for both SEQRES and ATOM records:

>d1vq9c1 c.22.1.1 (C:1-246) Ribosomal protein L4 {Archaeon Haloarcula marismortui [TaxId: 2238]}
mqatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes
fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad
adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs
argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal
aevaer

Timeline for d1vq9c1:

• d1vq9c1 is new in SCOP 1.73
  
• d1vq9c1 appears in SCOP 1.75
  
• d1vq9c1 appears in the current release, SCOPe 2.08