Class a: All alpha proteins [46456] (290 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein automated matches [190064] (21 species) not a true protein |
Species Jellyfish (Aequorea victoria) [TaxId:6100] [186782] (7 PDB entries) |
Domain d1uhhb_: 1uhh B: [119676] Other proteins in same PDB: d1uhha3 automated match to d1ej3a_ complexed with czp |
PDB Entry: 1uhh (more details), 1.8 Å
SCOPe Domain Sequences for d1uhhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uhhb_ a.39.1.5 (B:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]} ltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrhkdav eaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdkdqng aitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdpacek lyggavp
Timeline for d1uhhb_: