Lineage for d1uhha2 (1uhh A:2-189)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1994319Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1994320Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1994753Family a.39.1.5: Calmodulin-like [47502] (24 protein domains)
    Duplication: made with two pairs of EF-hands
  6. 1995301Protein automated matches [190064] (20 species)
    not a true protein
  7. 1995373Species Jellyfish (Aequorea victoria) [TaxId:6100] [186782] (4 PDB entries)
  8. 1995376Domain d1uhha2: 1uhh A:2-189 [119675]
    Other proteins in same PDB: d1uhha3
    automated match to d1ej3a_
    complexed with czp

Details for d1uhha2

PDB Entry: 1uhh (more details), 1.8 Å

PDB Description: Crystal structure of cp-aequorin
PDB Compounds: (A:) Aequorin 2

SCOPe Domain Sequences for d1uhha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uhha2 a.39.1.5 (A:2-189) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrhkda
veaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdkdqn
gaitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdpace
klyggavp

SCOPe Domain Coordinates for d1uhha2:

Click to download the PDB-style file with coordinates for d1uhha2.
(The format of our PDB-style files is described here.)

Timeline for d1uhha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uhha3
View in 3D
Domains from other chains:
(mouse over for more information)
d1uhhb_