SCOPe 2.08: Domain d1y19l1: 1y19 L:209-308

Lineage for d1y19l1 (1y19 L:209-308)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
   core: 3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.11.2: Second domain of FERM [47031] (2 families)
   automatically mapped to Pfam PF00373

5. Family a.11.2.1: Second domain of FERM [47032] (9 proteins)

6. Protein Talin-1 [116862] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [116863] (1 PDB entry)
   Uniprot P26039 209-410

8. Domain d1y19l1: 1y19 L:209-308 [116339]
   Other proteins in same PDB: d1y19b2, d1y19d2, d1y19f2, d1y19h2, d1y19j2, d1y19l2
   complexed with (covalently linked) peptide from PIP5KIgamma (Uniprot O70161 638-651), chains A, C, E, G, I and K

Details for d1y19l1

PDB Entry: 1y19, 2.6 Å

PDB Description: structural basis for phosphatidylinositol phosphate kinase type i- gamma binding to talin at focal adhesions

PDB Compounds: (L:) Talin 1

SCOPe Domain Sequences for d1y19l1:

Sequence; same for both SEQRES and ATOM records:

>d1y19l1 a.11.2.1 (L:209-308) Talin-1 {Mouse (Mus musculus) [TaxId: 10090]}
pvqlnllyvqarddilngshpvsfdkacefagfqcqiqfgphneqkhkagfldlkdflpk
eyvkqkgerkifqahkncgqmseieakvryvklarslkty

Timeline for d1y19l1:

• d1y19l1 first appeared in SCOP 1.71
  
• d1y19l1 appears in SCOPe 2.07