Lineage for d1y19d2 (1y19 D:309-400)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803543Family b.55.1.5: Third domain of FERM [50776] (8 proteins)
  6. 2803606Protein Talin-1 [117261] (1 species)
  7. 2803607Species Mouse (Mus musculus) [TaxId:10090] [117262] (1 PDB entry)
    Uniprot P26039 209-410
  8. 2803609Domain d1y19d2: 1y19 D:309-400 [116332]
    Other proteins in same PDB: d1y19b1, d1y19d1, d1y19f1, d1y19h1, d1y19j1, d1y19l1
    complexed with (covalently linked) peptide from PIP5KIgamma (Uniprot O70161 638-651), chains A, C, E, G, I and K

Details for d1y19d2

PDB Entry: 1y19 (more details), 2.6 Å

PDB Description: structural basis for phosphatidylinositol phosphate kinase type i- gamma binding to talin at focal adhesions
PDB Compounds: (D:) Talin 1

SCOPe Domain Sequences for d1y19d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y19d2 b.55.1.5 (D:309-400) Talin-1 {Mouse (Mus musculus) [TaxId: 10090]}
gvsfflvkekmkgknklvprllgitkecvmrvdektkeviqewsltnikrwaaspksftl
dfgdyqdgyysvqttegeqiaqliagyidiil

SCOPe Domain Coordinates for d1y19d2:

Click to download the PDB-style file with coordinates for d1y19d2.
(The format of our PDB-style files is described here.)

Timeline for d1y19d2: