PDB entry 1y19

View 1y19 on RCSB PDB site
Description: Structural basis for phosphatidylinositol phosphate kinase type I-gamma binding to talin at focal adhesions
Class: structural protein, signaling protein
Keywords: focal adhesion; ferm domain; cytoskeleton; npxy motif; ptb domain, structural protein, signaling protein
Deposited on 2004-11-17, released 2005-01-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-30, with a file datestamp of 2016-11-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol-4-phosphate 5-kinase, type 1 gamma
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Talin 1
    Species: Mus musculus [TaxId:10090]
    Gene: Tln1, Tln
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y19b1, d1y19b2
  • Chain 'C':
    Compound: Phosphatidylinositol-4-phosphate 5-kinase, type 1 gamma
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Talin 1
    Species: Mus musculus [TaxId:10090]
    Gene: Tln1, Tln
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y19d1, d1y19d2
  • Chain 'E':
    Compound: Phosphatidylinositol-4-phosphate 5-kinase, type 1 gamma
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Talin 1
    Species: Mus musculus [TaxId:10090]
    Gene: Tln1, Tln
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y19f1, d1y19f2
  • Chain 'G':
    Compound: Phosphatidylinositol-4-phosphate 5-kinase, type 1 gamma
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Talin 1
    Species: Mus musculus [TaxId:10090]
    Gene: Tln1, Tln
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y19h1, d1y19h2
  • Chain 'I':
    Compound: Phosphatidylinositol-4-phosphate 5-kinase, type 1 gamma
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Talin 1
    Species: Mus musculus [TaxId:10090]
    Gene: Tln1, Tln
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y19j1, d1y19j2
  • Chain 'K':
    Compound: Phosphatidylinositol-4-phosphate 5-kinase, type 1 gamma
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Talin 1
    Species: Mus musculus [TaxId:10090]
    Gene: Tln1, Tln
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y19l1, d1y19l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y19B (B:)
    pvqlnllyvqarddilngshpvsfdkacefagfqcqiqfgphneqkhkagfldlkdflpk
    eyvkqkgerkifqahkncgqmseieakvryvklarslktygvsfflvkekmkgknklvpr
    llgitkecvmrvdektkeviqewsltnikrwaaspksftldfgdyqdgyysvqttegeqi
    aqliagyidiilkkkkskdhfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y19B (B:)
    pvqlnllyvqarddilngshpvsfdkacefagfqcqiqfgphneqkhkagfldlkdflpk
    eyvkqkgerkifqahkncgqmseieakvryvklarslktygvsfflvkekmkgknklvpr
    llgitkecvmrvdektkeviqewsltnikrwaaspksftldfgdyqdgyysvqttegeqi
    aqliagyidiil
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1y19D (D:)
    pvqlnllyvqarddilngshpvsfdkacefagfqcqiqfgphneqkhkagfldlkdflpk
    eyvkqkgerkifqahkncgqmseieakvryvklarslktygvsfflvkekmkgknklvpr
    llgitkecvmrvdektkeviqewsltnikrwaaspksftldfgdyqdgyysvqttegeqi
    aqliagyidiilkkkkskdhfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y19D (D:)
    pvqlnllyvqarddilngshpvsfdkacefagfqcqiqfgphneqkhkagfldlkdflpk
    eyvkqkgerkifqahkncgqmseieakvryvklarslktygvsfflvkekmkgknklvpr
    llgitkecvmrvdektkeviqewsltnikrwaaspksftldfgdyqdgyysvqttegeqi
    aqliagyidiil
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1y19F (F:)
    pvqlnllyvqarddilngshpvsfdkacefagfqcqiqfgphneqkhkagfldlkdflpk
    eyvkqkgerkifqahkncgqmseieakvryvklarslktygvsfflvkekmkgknklvpr
    llgitkecvmrvdektkeviqewsltnikrwaaspksftldfgdyqdgyysvqttegeqi
    aqliagyidiilkkkkskdhfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y19F (F:)
    pvqlnllyvqarddilngshpvsfdkacefagfqcqiqfgphneqkhkagfldlkdflpk
    eyvkqkgerkifqahkncgqmseieakvryvklarslktygvsfflvkekmkgknklvpr
    llgitkecvmrvdektkeviqewsltnikrwaaspksftldfgdyqdgyysvqttegeqi
    aqliagyidiil
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1y19H (H:)
    pvqlnllyvqarddilngshpvsfdkacefagfqcqiqfgphneqkhkagfldlkdflpk
    eyvkqkgerkifqahkncgqmseieakvryvklarslktygvsfflvkekmkgknklvpr
    llgitkecvmrvdektkeviqewsltnikrwaaspksftldfgdyqdgyysvqttegeqi
    aqliagyidiilkkkkskdhfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y19H (H:)
    pvqlnllyvqarddilngshpvsfdkacefagfqcqiqfgphneqkhkagfldlkdflpk
    eyvkqkgerkifqahkncgqmseieakvryvklarslktygvsfflvkekmkgknklvpr
    llgitkecvmrvdektkeviqewsltnikrwaaspksftldfgdyqdgyysvqttegeqi
    aqliagyidiil
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1y19J (J:)
    pvqlnllyvqarddilngshpvsfdkacefagfqcqiqfgphneqkhkagfldlkdflpk
    eyvkqkgerkifqahkncgqmseieakvryvklarslktygvsfflvkekmkgknklvpr
    llgitkecvmrvdektkeviqewsltnikrwaaspksftldfgdyqdgyysvqttegeqi
    aqliagyidiilkkkkskdhfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y19J (J:)
    pvqlnllyvqarddilngshpvsfdkacefagfqcqiqfgphneqkhkagfldlkdflpk
    eyvkqkgerkifqahkncgqmseieakvryvklarslktygvsfflvkekmkgknklvpr
    llgitkecvmrvdektkeviqewsltnikrwaaspksftldfgdyqdgyysvqttegeqi
    aqliagyidiil
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1y19L (L:)
    pvqlnllyvqarddilngshpvsfdkacefagfqcqiqfgphneqkhkagfldlkdflpk
    eyvkqkgerkifqahkncgqmseieakvryvklarslktygvsfflvkekmkgknklvpr
    llgitkecvmrvdektkeviqewsltnikrwaaspksftldfgdyqdgyysvqttegeqi
    aqliagyidiilkkkkskdhfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y19L (L:)
    pvqlnllyvqarddilngshpvsfdkacefagfqcqiqfgphneqkhkagfldlkdflpk
    eyvkqkgerkifqahkncgqmseieakvryvklarslktygvsfflvkekmkgknklvpr
    llgitkecvmrvdektkeviqewsltnikrwaaspksftldfgdyqdgyysvqttegeqi
    aqliagyidiil