Lineage for d1y19d1 (1y19 D:209-308)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986009Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1986048Superfamily a.11.2: Second domain of FERM [47031] (2 families) (S)
    automatically mapped to Pfam PF00373
  5. 1986049Family a.11.2.1: Second domain of FERM [47032] (9 protein domains)
  6. 1986112Protein Talin-1 [116862] (1 species)
  7. 1986113Species Mouse (Mus musculus) [TaxId:10090] [116863] (1 PDB entry)
    Uniprot P26039 209-410
  8. 1986115Domain d1y19d1: 1y19 D:209-308 [116331]
    Other proteins in same PDB: d1y19b2, d1y19d2, d1y19f2, d1y19h2, d1y19j2, d1y19l2
    complexed with (covalently linked) peptide from PIP5KIgamma (Uniprot O70161 638-651), chains A, C, E, G, I and K

Details for d1y19d1

PDB Entry: 1y19 (more details), 2.6 Å

PDB Description: Structural basis for phosphatidylinositol phosphate kinase type I-gamma binding to talin at focal adhesions
PDB Compounds: (D:) Talin 1

SCOPe Domain Sequences for d1y19d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y19d1 a.11.2.1 (D:209-308) Talin-1 {Mouse (Mus musculus) [TaxId: 10090]}
pvqlnllyvqarddilngshpvsfdkacefagfqcqiqfgphneqkhkagfldlkdflpk
eyvkqkgerkifqahkncgqmseieakvryvklarslkty

SCOPe Domain Coordinates for d1y19d1:

Click to download the PDB-style file with coordinates for d1y19d1.
(The format of our PDB-style files is described here.)

Timeline for d1y19d1: