Class a: All alpha proteins [46456] (290 folds) |
Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.11.2: Second domain of FERM [47031] (2 families) automatically mapped to Pfam PF00373 |
Family a.11.2.1: Second domain of FERM [47032] (9 proteins) |
Protein Talin-1 [116862] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [116863] (1 PDB entry) Uniprot P26039 209-410 |
Domain d1y19b1: 1y19 B:209-308 [116329] Other proteins in same PDB: d1y19b2, d1y19d2, d1y19f2, d1y19h2, d1y19j2, d1y19l2 complexed with (covalently linked) peptide from PIP5KIgamma (Uniprot O70161 638-651), chains A, C, E, G, I and K |
PDB Entry: 1y19 (more details), 2.6 Å
SCOPe Domain Sequences for d1y19b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y19b1 a.11.2.1 (B:209-308) Talin-1 {Mouse (Mus musculus) [TaxId: 10090]} pvqlnllyvqarddilngshpvsfdkacefagfqcqiqfgphneqkhkagfldlkdflpk eyvkqkgerkifqahkncgqmseieakvryvklarslkty
Timeline for d1y19b1: