SCOPe 2.08: Domain d1y19l2: 1y19 L:309-400

Lineage for d1y19l2 (1y19 L:309-400)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.5: Third domain of FERM [50776] (8 proteins)

6. Protein Talin-1 [117261] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117262] (1 PDB entry)
   Uniprot P26039 209-410

8. Domain d1y19l2: 1y19 L:309-400 [116340]
   Other proteins in same PDB: d1y19b1, d1y19d1, d1y19f1, d1y19h1, d1y19j1, d1y19l1
   complexed with (covalently linked) peptide from PIP5KIgamma (Uniprot O70161 638-651), chains A, C, E, G, I and K

Details for d1y19l2

PDB Entry: 1y19, 2.6 Å

PDB Description: structural basis for phosphatidylinositol phosphate kinase type i- gamma binding to talin at focal adhesions

PDB Compounds: (L:) Talin 1

SCOPe Domain Sequences for d1y19l2:

Sequence; same for both SEQRES and ATOM records:

>d1y19l2 b.55.1.5 (L:309-400) Talin-1 {Mouse (Mus musculus) [TaxId: 10090]}
gvsfflvkekmkgknklvprllgitkecvmrvdektkeviqewsltnikrwaaspksftl
dfgdyqdgyysvqttegeqiaqliagyidiil

Timeline for d1y19l2:

• d1y19l2 first appeared in SCOP 1.71
  
• d1y19l2 appears in SCOPe 2.07