Lineage for d1xmab1 (1xma B:2-106)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983461Family a.4.5.61: PadR-like [116807] (3 protein domains)
    Pfam PF03551; related to the MarR-like family (Pfam PF01047)
  6. 1983468Protein Predicted transcriptional regulator [116808] (1 species)
    monomeric
  7. 1983469Species Clostridium thermocellum [TaxId:1515] [116809] (1 PDB entry)
    Uniprot Q4CEJ8 4-106
  8. 1983471Domain d1xmab1: 1xma B:2-106 [115478]
    Other proteins in same PDB: d1xmab2
    complexed with hg, unx

Details for d1xmab1

PDB Entry: 1xma (more details), 2.3 Å

PDB Description: Structure of a transcriptional regulator from Clostridium thermocellum Cth-833
PDB Compounds: (B:) Predicted transcriptional regulator

SCOPe Domain Sequences for d1xmab1:

Sequence, based on SEQRES records: (download)

>d1xmab1 a.4.5.61 (B:2-106) Predicted transcriptional regulator {Clostridium thermocellum [TaxId: 1515]}
issdvirgyvdtiilslliegdsygyeiskniriktdelyvikettlysafarlekngyi
ksyygeetqgkrrtyyritpegikyykqkceeweltkkvinkfvk

Sequence, based on observed residues (ATOM records): (download)

>d1xmab1 a.4.5.61 (B:2-106) Predicted transcriptional regulator {Clostridium thermocellum [TaxId: 1515]}
issdvirgyvdtiilslliegdsygyeiskniriktdelyvikettlysafarlekngyi
ksyygeetrrtyyritpegikyykqkceeweltkkvinkfvk

SCOPe Domain Coordinates for d1xmab1:

Click to download the PDB-style file with coordinates for d1xmab1.
(The format of our PDB-style files is described here.)

Timeline for d1xmab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xmab2
View in 3D
Domains from other chains:
(mouse over for more information)
d1xmaa_