| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.61: PadR-like [116807] (3 proteins) Pfam PF03551; related to the MarR-like family (Pfam PF01047) |
| Protein Predicted transcriptional regulator [116808] (1 species) monomeric |
| Species Clostridium thermocellum [TaxId:1515] [116809] (1 PDB entry) Uniprot Q4CEJ8 4-106 |
| Domain d1xmab1: 1xma B:2-106 [115478] Other proteins in same PDB: d1xmab2 complexed with hg, unx |
PDB Entry: 1xma (more details), 2.3 Å
SCOPe Domain Sequences for d1xmab1:
Sequence, based on SEQRES records: (download)
>d1xmab1 a.4.5.61 (B:2-106) Predicted transcriptional regulator {Clostridium thermocellum [TaxId: 1515]}
issdvirgyvdtiilslliegdsygyeiskniriktdelyvikettlysafarlekngyi
ksyygeetqgkrrtyyritpegikyykqkceeweltkkvinkfvk
>d1xmab1 a.4.5.61 (B:2-106) Predicted transcriptional regulator {Clostridium thermocellum [TaxId: 1515]}
issdvirgyvdtiilslliegdsygyeiskniriktdelyvikettlysafarlekngyi
ksyygeetrrtyyritpegikyykqkceeweltkkvinkfvk
Timeline for d1xmab1: