SCOPe 2.08: Domain d1xmab1: 1xma B:2-106

Lineage for d1xmab1 (1xma B:2-106)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.61: PadR-like [116807] (3 proteins)
   Pfam PF03551; related to the MarR-like family (Pfam PF01047)

6. Protein Predicted transcriptional regulator [116808] (1 species)
   monomeric

7. Species Clostridium thermocellum [TaxId:1515] [116809] (1 PDB entry)
   Uniprot Q4CEJ8 4-106

8. Domain d1xmab1: 1xma B:2-106 [115478]
   Other proteins in same PDB: d1xmab2
   complexed with hg, unx

Details for d1xmab1

PDB Entry: 1xma, 2.3 Å

PDB Description: structure of a transcriptional regulator from clostridium thermocellum cth-833

PDB Compounds: (B:) Predicted transcriptional regulator

SCOPe Domain Sequences for d1xmab1:

Sequence, based on SEQRES records:

>d1xmab1 a.4.5.61 (B:2-106) Predicted transcriptional regulator {Clostridium thermocellum [TaxId: 1515]}
issdvirgyvdtiilslliegdsygyeiskniriktdelyvikettlysafarlekngyi
ksyygeetqgkrrtyyritpegikyykqkceeweltkkvinkfvk

Sequence, based on observed residues (ATOM records):

>d1xmab1 a.4.5.61 (B:2-106) Predicted transcriptional regulator {Clostridium thermocellum [TaxId: 1515]}
issdvirgyvdtiilslliegdsygyeiskniriktdelyvikettlysafarlekngyi
ksyygeetrrtyyritpegikyykqkceeweltkkvinkfvk

Timeline for d1xmab1:

• d1xmab1 first appeared in SCOP 1.71, called d1xmab_
  
• d1xmab1 appears in SCOPe 2.07