PDB entry 1xma

View 1xma on RCSB PDB site
Description: Structure of a transcriptional regulator from Clostridium thermocellum Cth-833
Class: transcription
Keywords: Clostridium thermocellum, transcriptional regulator, Southeast Collaboratory for Structural Genomics, SECSG, Protein Structure Initiative, PSI, TRANSCRIPTION
Deposited on 2004-10-01, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Predicted transcriptional regulator
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00312398
    Domains in SCOPe 2.07: d1xmaa_
  • Chain 'B':
    Compound: Predicted transcriptional regulator
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00312398 (32-End)
      • expression tag (31)
    Domains in SCOPe 2.07: d1xmab1, d1xmab2
  • Heterogens: HG, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xmaA (A:)
    mgsshhhhhhssglvprgsqstslykkaglmvissdvirgyvdtiilslliegdsygyei
    skniriktdelyvikettlysafarlekngyiksyygeetqgkrrtyyritpegikyykq
    kceeweltkkvinkfvkelesngdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmaA (A:)
    sdvirgyvdtiilslliegdsygyeiskniriktdelyvikettlysafarlekngyiks
    yygeetkrrtyyritpegikyykqkceeweltkkvinkfvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xmaB (B:)
    mgsshhhhhhssglvprgsqstslykkaglmvissdvirgyvdtiilslliegdsygyei
    skniriktdelyvikettlysafarlekngyiksyygeetqgkrrtyyritpegikyykq
    kceeweltkkvinkfvkelesngdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmaB (B:)
    vissdvirgyvdtiilslliegdsygyeiskniriktdelyvikettlysafarlekngy
    iksyygeetrrtyyritpegikyykqkceeweltkkvinkfvk