Lineage for d1xmab_ (1xma B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 533238Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (61 families) (S)
    contains a small beta-sheet (wing)
  5. 533953Family a.4.5.61: PadR-like [116807] (2 proteins)
    Pfam 03551; related to the MarR-like family (Pfam 01047)
  6. 533957Protein Predicted transcriptional regulator [116808] (1 species)
    monomeric
  7. 533958Species Clostridium thermocellum [TaxId:1515] [116809] (1 PDB entry)
  8. 533960Domain d1xmab_: 1xma B: [115478]
    complexed with hg, unx

Details for d1xmab_

PDB Entry: 1xma (more details), 2.3 Å

PDB Description: structure of a transcriptional regulator from clostridium thermocellum cth-833

SCOP Domain Sequences for d1xmab_:

Sequence, based on SEQRES records: (download)

>d1xmab_ a.4.5.61 (B:) Predicted transcriptional regulator {Clostridium thermocellum}
vissdvirgyvdtiilslliegdsygyeiskniriktdelyvikettlysafarlekngy
iksyygeetqgkrrtyyritpegikyykqkceeweltkkvinkfvk

Sequence, based on observed residues (ATOM records): (download)

>d1xmab_ a.4.5.61 (B:) Predicted transcriptional regulator {Clostridium thermocellum}
vissdvirgyvdtiilslliegdsygyeiskniriktdelyvikettlysafarlekngy
iksyygeetrrtyyritpegikyykqkceeweltkkvinkfvk

SCOP Domain Coordinates for d1xmab_:

Click to download the PDB-style file with coordinates for d1xmab_.
(The format of our PDB-style files is described here.)

Timeline for d1xmab_: