Lineage for d1xmaa_ (1xma A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694313Family a.4.5.61: PadR-like [116807] (3 proteins)
    Pfam PF03551; related to the MarR-like family (Pfam PF01047)
  6. 2694320Protein Predicted transcriptional regulator [116808] (1 species)
    monomeric
  7. 2694321Species Clostridium thermocellum [TaxId:1515] [116809] (1 PDB entry)
    Uniprot Q4CEJ8 4-106
  8. 2694322Domain d1xmaa_: 1xma A: [115477]
    Other proteins in same PDB: d1xmab2
    complexed with hg, unx

Details for d1xmaa_

PDB Entry: 1xma (more details), 2.3 Å

PDB Description: structure of a transcriptional regulator from clostridium thermocellum cth-833
PDB Compounds: (A:) Predicted transcriptional regulator

SCOPe Domain Sequences for d1xmaa_:

Sequence, based on SEQRES records: (download)

>d1xmaa_ a.4.5.61 (A:) Predicted transcriptional regulator {Clostridium thermocellum [TaxId: 1515]}
sdvirgyvdtiilslliegdsygyeiskniriktdelyvikettlysafarlekngyiks
yygeetqgkrrtyyritpegikyykqkceeweltkkvinkfvk

Sequence, based on observed residues (ATOM records): (download)

>d1xmaa_ a.4.5.61 (A:) Predicted transcriptional regulator {Clostridium thermocellum [TaxId: 1515]}
sdvirgyvdtiilslliegdsygyeiskniriktdelyvikettlysafarlekngyiks
yygeetkrrtyyritpegikyykqkceeweltkkvinkfvk

SCOPe Domain Coordinates for d1xmaa_:

Click to download the PDB-style file with coordinates for d1xmaa_.
(The format of our PDB-style files is described here.)

Timeline for d1xmaa_: