Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins) this domain interrupts the other domain which defines family |
Protein S-adenosylhomocystein hydrolase [51845] (3 species) |
Species Plasmodium falciparum, isolate 3D7 [TaxId:5833] [117431] (1 PDB entry) Uniprot P50250 |
Domain d1v8bd1: 1v8b D:235-397 [113570] Other proteins in same PDB: d1v8ba2, d1v8bb2, d1v8bc2, d1v8bd2 complexed with adn, nad |
PDB Entry: 1v8b (more details), 2.4 Å
SCOPe Domain Sequences for d1v8bd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v8bd1 c.2.1.4 (D:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} nvygcrhslpdglmratdflisgkivvicgygdvgkgcassmkglgarvyiteidpicai qavmegfnvvtldeivdkgdffitctgnvdviklehllkmknnavvgnighfddeiqvne lfnykgihienvkpqvdritlpngnkiivlargrllnlgcatg
Timeline for d1v8bd1: