Lineage for d1v8ba1 (1v8b A:235-397)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844156Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 2844257Protein S-adenosylhomocystein hydrolase [51845] (3 species)
  7. 2844301Species Plasmodium falciparum, isolate 3D7 [TaxId:5833] [117431] (1 PDB entry)
    Uniprot P50250
  8. 2844302Domain d1v8ba1: 1v8b A:235-397 [113564]
    Other proteins in same PDB: d1v8ba2, d1v8bb2, d1v8bc2, d1v8bd2
    complexed with adn, nad

Details for d1v8ba1

PDB Entry: 1v8b (more details), 2.4 Å

PDB Description: Crystal structure of a hydrolase
PDB Compounds: (A:) Adenosylhomocysteinase

SCOPe Domain Sequences for d1v8ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]}
nvygcrhslpdglmratdflisgkivvicgygdvgkgcassmkglgarvyiteidpicai
qavmegfnvvtldeivdkgdffitctgnvdviklehllkmknnavvgnighfddeiqvne
lfnykgihienvkpqvdritlpngnkiivlargrllnlgcatg

SCOPe Domain Coordinates for d1v8ba1:

Click to download the PDB-style file with coordinates for d1v8ba1.
(The format of our PDB-style files is described here.)

Timeline for d1v8ba1: