PDB entry 1v8b

View 1v8b on RCSB PDB site
Description: Crystal structure of a hydrolase
Class: Hydrolase
Keywords: Hydrolase
Deposited on 2004-01-03, released 2004-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.214
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenosylhomocysteinase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v8ba1, d1v8ba2
  • Chain 'B':
    Compound: Adenosylhomocysteinase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v8bb1, d1v8bb2
  • Chain 'C':
    Compound: Adenosylhomocysteinase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v8bc1, d1v8bc2
  • Chain 'D':
    Compound: Adenosylhomocysteinase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v8bd1, d1v8bd2
  • Heterogens: NAD, ADN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v8bA (A:)
    mvenkskvkdislapfgkmqmeisenempglmrireeygkdqplknakitgclhmtveca
    llietlqklgaqirwcscniystadyaaaavstlenvtvfawknetleeywwcvesaltw
    gdgddngpdmivddggdatllvhkgveyeklyeeknilpdpekakneeercfltllknsi
    lknpkkwtniakkiigvseetttgvlrlkkmdkqnellftainvndavtkqkydnvygcr
    hslpdglmratdflisgkivvicgygdvgkgcassmkglgarvyiteidpicaiqavmeg
    fnvvtldeivdkgdffitctgnvdviklehllkmknnavvgnighfddeiqvnelfnykg
    ihienvkpqvdritlpngnkiivlargrllnlgcatghpafvmsfsfcnqtfaqldlwqn
    kdtnkyenkvyllpkhldekvalyhlkklnasltelddnqcqflgvnksgpfksneyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8bA (A:)
    nkskvkdislapfgkmqmeisenempglmrireeygkdqplknakitgclhmtvecalli
    etlqklgaqirwcscniystadyaaaavstlenvtvfawknetleeywwcvesaltwgdg
    ddngpdmivddggdatllvhkgveyeklyeeknilpdpekakneeercfltllknsilkn
    pkkwtniakkiigvseetttgvlrlkkmdkqnellftainvndavtkqkydnvygcrhsl
    pdglmratdflisgkivvicgygdvgkgcassmkglgarvyiteidpicaiqavmegfnv
    vtldeivdkgdffitctgnvdviklehllkmknnavvgnighfddeiqvnelfnykgihi
    envkpqvdritlpngnkiivlargrllnlgcatghpafvmsfsfcnqtfaqldlwqnkdt
    nkyenkvyllpkhldekvalyhlkklnasltelddnqcqflgvnksgpfksneyry
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v8bB (B:)
    mvenkskvkdislapfgkmqmeisenempglmrireeygkdqplknakitgclhmtveca
    llietlqklgaqirwcscniystadyaaaavstlenvtvfawknetleeywwcvesaltw
    gdgddngpdmivddggdatllvhkgveyeklyeeknilpdpekakneeercfltllknsi
    lknpkkwtniakkiigvseetttgvlrlkkmdkqnellftainvndavtkqkydnvygcr
    hslpdglmratdflisgkivvicgygdvgkgcassmkglgarvyiteidpicaiqavmeg
    fnvvtldeivdkgdffitctgnvdviklehllkmknnavvgnighfddeiqvnelfnykg
    ihienvkpqvdritlpngnkiivlargrllnlgcatghpafvmsfsfcnqtfaqldlwqn
    kdtnkyenkvyllpkhldekvalyhlkklnasltelddnqcqflgvnksgpfksneyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8bB (B:)
    nkskvkdislapfgkmqmeisenempglmrireeygkdqplknakitgclhmtvecalli
    etlqklgaqirwcscniystadyaaaavstlenvtvfawknetleeywwcvesaltwgdg
    ddngpdmivddggdatllvhkgveyeklyeeknilpdpekakneeercfltllknsilkn
    pkkwtniakkiigvseetttgvlrlkkmdkqnellftainvndavtkqkydnvygcrhsl
    pdglmratdflisgkivvicgygdvgkgcassmkglgarvyiteidpicaiqavmegfnv
    vtldeivdkgdffitctgnvdviklehllkmknnavvgnighfddeiqvnelfnykgihi
    envkpqvdritlpngnkiivlargrllnlgcatghpafvmsfsfcnqtfaqldlwqnkdt
    nkyenkvyllpkhldekvalyhlkklnasltelddnqcqflgvnksgpfksneyry
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1v8bC (C:)
    mvenkskvkdislapfgkmqmeisenempglmrireeygkdqplknakitgclhmtveca
    llietlqklgaqirwcscniystadyaaaavstlenvtvfawknetleeywwcvesaltw
    gdgddngpdmivddggdatllvhkgveyeklyeeknilpdpekakneeercfltllknsi
    lknpkkwtniakkiigvseetttgvlrlkkmdkqnellftainvndavtkqkydnvygcr
    hslpdglmratdflisgkivvicgygdvgkgcassmkglgarvyiteidpicaiqavmeg
    fnvvtldeivdkgdffitctgnvdviklehllkmknnavvgnighfddeiqvnelfnykg
    ihienvkpqvdritlpngnkiivlargrllnlgcatghpafvmsfsfcnqtfaqldlwqn
    kdtnkyenkvyllpkhldekvalyhlkklnasltelddnqcqflgvnksgpfksneyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8bC (C:)
    nkskvkdislapfgkmqmeisenempglmrireeygkdqplknakitgclhmtvecalli
    etlqklgaqirwcscniystadyaaaavstlenvtvfawknetleeywwcvesaltwgdg
    ddngpdmivddggdatllvhkgveyeklyeeknilpdpekakneeercfltllknsilkn
    pkkwtniakkiigvseetttgvlrlkkmdkqnellftainvndavtkqkydnvygcrhsl
    pdglmratdflisgkivvicgygdvgkgcassmkglgarvyiteidpicaiqavmegfnv
    vtldeivdkgdffitctgnvdviklehllkmknnavvgnighfddeiqvnelfnykgihi
    envkpqvdritlpngnkiivlargrllnlgcatghpafvmsfsfcnqtfaqldlwqnkdt
    nkyenkvyllpkhldekvalyhlkklnasltelddnqcqflgvnksgpfksneyry
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1v8bD (D:)
    mvenkskvkdislapfgkmqmeisenempglmrireeygkdqplknakitgclhmtveca
    llietlqklgaqirwcscniystadyaaaavstlenvtvfawknetleeywwcvesaltw
    gdgddngpdmivddggdatllvhkgveyeklyeeknilpdpekakneeercfltllknsi
    lknpkkwtniakkiigvseetttgvlrlkkmdkqnellftainvndavtkqkydnvygcr
    hslpdglmratdflisgkivvicgygdvgkgcassmkglgarvyiteidpicaiqavmeg
    fnvvtldeivdkgdffitctgnvdviklehllkmknnavvgnighfddeiqvnelfnykg
    ihienvkpqvdritlpngnkiivlargrllnlgcatghpafvmsfsfcnqtfaqldlwqn
    kdtnkyenkvyllpkhldekvalyhlkklnasltelddnqcqflgvnksgpfksneyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8bD (D:)
    nkskvkdislapfgkmqmeisenempglmrireeygkdqplknakitgclhmtvecalli
    etlqklgaqirwcscniystadyaaaavstlenvtvfawknetleeywwcvesaltwgdg
    ddngpdmivddggdatllvhkgveyeklyeeknilpdpekakneeercfltllknsilkn
    pkkwtniakkiigvseetttgvlrlkkmdkqnellftainvndavtkqkydnvygcrhsl
    pdglmratdflisgkivvicgygdvgkgcassmkglgarvyiteidpicaiqavmegfnv
    vtldeivdkgdffitctgnvdviklehllkmknnavvgnighfddeiqvnelfnykgihi
    envkpqvdritlpngnkiivlargrllnlgcatghpafvmsfsfcnqtfaqldlwqnkdt
    nkyenkvyllpkhldekvalyhlkklnasltelddnqcqflgvnksgpfksneyry