Lineage for d1v8bd2 (1v8b D:4-234,D:398-479)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857659Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 2857771Family c.23.12.3: S-adenosylhomocystein hydrolase [52300] (1 protein)
  6. 2857772Protein S-adenosylhomocystein hydrolase [52301] (3 species)
    contains additional secondary structures disguising the superfamily fold
  7. 2857816Species Plasmodium falciparum, isolate 3D7 [TaxId:5833] [117480] (1 PDB entry)
    Uniprot P50250
  8. 2857820Domain d1v8bd2: 1v8b D:4-234,D:398-479 [113571]
    Other proteins in same PDB: d1v8ba1, d1v8bb1, d1v8bc1, d1v8bd1
    complexed with adn, nad

Details for d1v8bd2

PDB Entry: 1v8b (more details), 2.4 Å

PDB Description: Crystal structure of a hydrolase
PDB Compounds: (D:) Adenosylhomocysteinase

SCOPe Domain Sequences for d1v8bd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v8bd2 c.23.12.3 (D:4-234,D:398-479) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]}
nkskvkdislapfgkmqmeisenempglmrireeygkdqplknakitgclhmtvecalli
etlqklgaqirwcscniystadyaaaavstlenvtvfawknetleeywwcvesaltwgdg
ddngpdmivddggdatllvhkgveyeklyeeknilpdpekakneeercfltllknsilkn
pkkwtniakkiigvseetttgvlrlkkmdkqnellftainvndavtkqkydXhpafvmsf
sfcnqtfaqldlwqnkdtnkyenkvyllpkhldekvalyhlkklnasltelddnqcqflg
vnksgpfksneyry

SCOPe Domain Coordinates for d1v8bd2:

Click to download the PDB-style file with coordinates for d1v8bd2.
(The format of our PDB-style files is described here.)

Timeline for d1v8bd2: