SCOPe 2.08: Domain d1tyeb3: 1tye B:1-57

Lineage for d1tyeb3 (1tye B:1-57)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies)
   disulfide-rich fold; common core is alpha+beta with two conserved disulfides

4. Superfamily g.16.2: Plexin repeat [103575] (1 family)

5. Family g.16.2.1: Plexin repeat [103576] (3 proteins)
   Pfam PF01437

6. Protein Integrin beta-3 [118249] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [118250] (6 PDB entries)
   Uniprot P05106 27-716 ! Uniprot P05106 27-466

8. Domain d1tyeb3: 1tye B:1-57 [112832]
   Other proteins in same PDB: d1tyea_, d1tyeb1, d1tyeb2, d1tyec_, d1tyed1, d1tyed2, d1tyee_, d1tyef1, d1tyef2
   complexed with ca, cac, mg, nag

Details for d1tyeb3

PDB Entry: 1tye, 2.9 Å

PDB Description: structural basis for allostery in integrins and binding of ligand- mimetic therapeutics to the platelet receptor for fibrinogen

PDB Compounds: (B:) integrin beta-3

SCOPe Domain Sequences for d1tyeb3:

Sequence; same for both SEQRES and ATOM records:

>d1tyeb3 g.16.2.1 (B:1-57) Integrin beta-3 {Human (Homo sapiens) [TaxId: 9606]}
gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncapesiefp

Timeline for d1tyeb3:

• d1tyeb3 first appeared in SCOP 1.71
  
• d1tyeb3 appears in SCOPe 2.07