Lineage for d1tyef2 (1tye F:107-354)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. Protein Integrin beta A domain [69542] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [69543] (9 PDB entries)
    Uniprot P05106 27-716 ! Uniprot P05106 27-466
  8. Domain d1tyef2: 1tye F:107-354 [112839]
    Other proteins in same PDB: d1tyea_, d1tyeb1, d1tyeb3, d1tyec_, d1tyed1, d1tyed3, d1tyee_, d1tyef1, d1tyef3
    complexed with ca, cac, mg, nag

Details for d1tyef2

PDB Entry: 1tye (more details), 2.9 Å

PDB Description: structural basis for allostery in integrins and binding of ligand- mimetic therapeutics to the platelet receptor for fibrinogen
PDB Compounds: (F:) integrin beta-3

SCOPe Domain Sequences for d1tyef2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tyef2 c.62.1.1 (F:107-354) Integrin beta A domain {Human (Homo sapiens) [TaxId: 9606]}
vedypvdiyylmdlsysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymy
isppealenpcydmkttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdai
mqatvcdekigwrndashllvfttdakthialdgrlagivqpndgqchvgsdnhysastt
mdypslglmteklsqkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivd
aygkirsk

SCOPe Domain Coordinates for d1tyef2 are not available.

Timeline for d1tyef2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tyef1, d1tyef3
View in 3D
Domains from other chains:
(mouse over for more information)
d1tyea_, d1tyeb1, d1tyeb2, d1tyeb3, d1tyec_, d1tyed1, d1tyed2, d1tyed3, d1tyee_