![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.62.1: vWA-like [53300] (6 families) ![]() |
![]() | Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins) |
![]() | Protein Integrin beta A domain [69542] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69543] (9 PDB entries) Uniprot P05106 27-716 ! Uniprot P05106 27-466 |
![]() | Domain d1tyef2: 1tye F:107-354 [112839] Other proteins in same PDB: d1tyea_, d1tyeb1, d1tyeb3, d1tyec_, d1tyed1, d1tyed3, d1tyee_, d1tyef1, d1tyef3 complexed with ca, cac, mg, nag |
PDB Entry: 1tye (more details), 2.9 Å
SCOPe Domain Sequences for d1tyef2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tyef2 c.62.1.1 (F:107-354) Integrin beta A domain {Human (Homo sapiens) [TaxId: 9606]} vedypvdiyylmdlsysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymy isppealenpcydmkttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdai mqatvcdekigwrndashllvfttdakthialdgrlagivqpndgqchvgsdnhysastt mdypslglmteklsqkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivd aygkirsk
Timeline for d1tyef2: