SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1tyed1 (1tye D:58-106,D:355-440)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2032015Superfamily b.1.15: Integrin domains [69179] (2 families) (S)
  5. 2032016Family b.1.15.1: Integrin domains [69180] (2 protein domains)
  6. 2032017Protein Hybrid domain of integrin beta [69183] (1 species)
  7. 2032018Species Human (Homo sapiens) [TaxId:9606] [69184] (9 PDB entries)
    Uniprot P05106 27-466
  8. 2032024Domain d1tyed1: 1tye D:58-106,D:355-440 [112834]
    Other proteins in same PDB: d1tyea_, d1tyeb2, d1tyeb3, d1tyec_, d1tyed2, d1tyed3, d1tyee_, d1tyef2, d1tyef3
    complexed with ca, cac, mg, nag

Details for d1tyed1

PDB Entry: 1tye (more details), 2.9 Å

PDB Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen
PDB Compounds: (D:) integrin beta-3

SCOPe Domain Sequences for d1tyed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tyed1 b.1.15.1 (D:58-106,D:355-440) Hybrid domain of integrin beta {Human (Homo sapiens) [TaxId: 9606]}
vsearvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqXvelevrdlpe
elslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvgfkds
livqvtfdcdcacqaq

SCOPe Domain Coordinates for d1tyed1:

Click to download the PDB-style file with coordinates for d1tyed1.
(The format of our PDB-style files is described here.)

Timeline for d1tyed1: