Domain d1tyef3: 1tye F:1-57

Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)

Lineage for d1tyef3 (1tye F:1-57)

Root: SCOP 1.75B
Class g: Small proteins [56992] (90 folds)
Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies)
disulfide-rich fold; common core is alpha+beta with two conserved disulfides
Superfamily g.16.2: Plexin repeat [103575] (1 family)
Family g.16.2.1: Plexin repeat [103576] (3 protein domains)
Pfam PF01437
Protein Integrin beta-3 [118249] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [118250] (2 PDB entries)
Uniprot P05106 27-716 ! Uniprot P05106 27-466
Domain d1tyef3: 1tye F:1-57 [112840]
Other proteins in same PDB: d1tyea_, d1tyeb1, d1tyeb2, d1tyec_, d1tyed1, d1tyed2, d1tyee_, d1tyef1, d1tyef2
complexed with ca, cac, mg, nag

PDB Entry: 1tye (more details)
PDB Description: structural basis for allostery in integrins and binding of l mimetic therapeutics to the platelet receptor for fibrinoge
PDB Compounds: (F:) integrin beta-3

SCOP Domain Sequences for d1tyef3:
Sequence; same for both SEQRES and ATOM records: (download)

>d1tyef3 g.16.2.1 (F:1-57) Integrin beta-3 {Human (Homo sapiens) [TaxId: 9606]} gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncapesiefp

SCOP Domain Coordinates for d1tyef3:

Click to download the PDB-style file with coordinates for d1tyef3.
(The format of our PDB-style files is described here.)

Timeline for d1tyef3:
d1tyef3 appears in SCOP 1.75A

d1tyef3
(click for larger image)

d1tyef3 in context of chain
Domains from same chain:
d1tyef1, d1tyef2

d1tyef3 in context of PDB
Domains from other chains:
d1tyea_, d1tyeb1, d1tyeb2, d1tyeb3, d1tyec_, d1tyed1, d1tyed2, d1tyed3, d1tyee_