Lineage for d1tyeb3 (1tye B:1-57)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 623301Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies)
    disulfide-rich fold; common core is alpha+beta with two conserved disulfides
  4. 623330Superfamily g.16.2: Plexin repeat [103575] (1 family) (S)
  5. 623331Family g.16.2.1: Plexin repeat [103576] (3 proteins)
    Pfam 01437
  6. 623336Protein Integrin beta-3 [118249] (1 species)
  7. 623337Species Human (Homo sapiens) [TaxId:9606] [118250] (7 PDB entries)
  8. 623341Domain d1tyeb3: 1tye B:1-57 [112832]
    Other proteins in same PDB: d1tyea_, d1tyeb1, d1tyeb2, d1tyec_, d1tyed1, d1tyed2, d1tyee_, d1tyef1, d1tyef2

Details for d1tyeb3

PDB Entry: 1tye (more details), 2.9 Å

PDB Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen

SCOP Domain Sequences for d1tyeb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tyeb3 g.16.2.1 (B:1-57) Integrin beta-3 {Human (Homo sapiens)}
gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncapesiefp

SCOP Domain Coordinates for d1tyeb3:

Click to download the PDB-style file with coordinates for d1tyeb3.
(The format of our PDB-style files is described here.)

Timeline for d1tyeb3: