Lineage for d1sb3d2 (1sb3 D:134-768)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2540508Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 2540509Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (2 families) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
    automatically mapped to Pfam PF02738
  5. 2540510Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (7 protein domains)
  6. 2540511Protein 4-hydroxybenzoyl-CoA reductase alpha subunit HrcA, C-terminal domain [118109] (1 species)
  7. 2540512Species Thauera aromatica [TaxId:59405] [118110] (2 PDB entries)
    Uniprot O33819
  8. 2540516Domain d1sb3d2: 1sb3 D:134-768 [112059]
    Other proteins in same PDB: d1sb3a1, d1sb3b1, d1sb3b2, d1sb3c1, d1sb3c2, d1sb3d1, d1sb3e1, d1sb3e2, d1sb3f1, d1sb3f2
    complexed with epe, fad, fes, pcd, sf4, so4

Details for d1sb3d2

PDB Entry: 1sb3 (more details), 2.2 Å

PDB Description: Structure of 4-hydroxybenzoyl-CoA reductase from Thauera aromatica
PDB Compounds: (D:) 4-hydroxybenzoyl-CoA reductase alpha subunit

SCOPe Domain Sequences for d1sb3d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sb3d2 d.133.1.1 (D:134-768) 4-hydroxybenzoyl-CoA reductase alpha subunit HrcA, C-terminal domain {Thauera aromatica [TaxId: 59405]}
mtpkaamkagaialhddkpnnilrevhaefgdvaaafaeadlirektytfaevnhvhmel
natlaeydpvrdmltlntttqvpyyvhlkvaaclqmdsarirvikpflgggfgartealh
feiiagllarkakgtvrllqtreetfiahrgrpwtevkmkiglkkdgkiaalaleatqag
gayagygiitilytgalmhglyhipaikhdawrvytntppcgamrghgtvdtraafeall
temgeelgidslkirqinmlpqipyvtmyaqrvmsygvpeclekvkaasgweerkgklpk
grglgialshfvsgtstpkhwtgephatvnlkldfdggitlltgaadigqgsntmasqva
aevlgvrlsrirvisadsaltpkdngsyssrvtfmvgnasisaaeelkgvlvkaaakkld
areedievidemfmvsgsqdpglsfqevvkaamvdsgtitvkgtytcptefqgdkkirgs
aigatmgfcyaaqvveasvdeitgkvtahkvwvavdvgkalnplavegqtqggvwmgmgq
alseetvydngrmvhgnildyrvptivespdieviivesmdpngpfgakeasegmlagfl
paiheavyeavgvratdfplspdritelldakeaa

SCOPe Domain Coordinates for d1sb3d2:

Click to download the PDB-style file with coordinates for d1sb3d2.
(The format of our PDB-style files is described here.)

Timeline for d1sb3d2: