Lineage for d1sb3f2 (1sb3 F:1-81)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2933988Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2933989Protein 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, N-terminal domain [117836] (1 species)
  7. 2933990Species Thauera aromatica [TaxId:59405] [117837] (2 PDB entries)
    Uniprot O33818
  8. 2933994Domain d1sb3f2: 1sb3 F:1-81 [112063]
    Other proteins in same PDB: d1sb3a1, d1sb3a2, d1sb3b1, d1sb3b2, d1sb3c1, d1sb3d1, d1sb3d2, d1sb3e1, d1sb3e2, d1sb3f1
    complexed with epe, fad, fes, pcd, sf4, so4

Details for d1sb3f2

PDB Entry: 1sb3 (more details), 2.2 Å

PDB Description: Structure of 4-hydroxybenzoyl-CoA reductase from Thauera aromatica
PDB Compounds: (F:) 4-hydroxybenzoyl-CoA reductase gamma subunit

SCOPe Domain Sequences for d1sb3f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sb3f2 d.15.4.2 (F:1-81) 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, N-terminal domain {Thauera aromatica [TaxId: 59405]}
mknilrltlngraredlvpdnmllldylretvgltgtkqgcdggecgactvlvddrprla
cstlahqvagkkvetveslat

SCOPe Domain Coordinates for d1sb3f2:

Click to download the PDB-style file with coordinates for d1sb3f2.
(The format of our PDB-style files is described here.)

Timeline for d1sb3f2: