Lineage for d1sb3b1 (1sb3 B:217-323)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) (S)
    automatically mapped to Pfam PF03450
  5. Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins)
  6. Protein 4-hydroxybenzoyl-CoA reductase beta subunit HrcB, C-terminal domain [118044] (1 species)
  7. Species Thauera aromatica [TaxId:59405] [118045] (2 PDB entries)
    Uniprot O33820
  8. Domain d1sb3b1: 1sb3 B:217-323 [112054]
    Other proteins in same PDB: d1sb3a1, d1sb3a2, d1sb3b2, d1sb3c1, d1sb3c2, d1sb3d1, d1sb3d2, d1sb3e2, d1sb3f1, d1sb3f2
    complexed with epe, fad, fes, pcd, sf4, so4

Details for d1sb3b1

PDB Entry: 1sb3 (more details), 2.2 Å

PDB Description: Structure of 4-hydroxybenzoyl-CoA reductase from Thauera aromatica
PDB Compounds: (B:) 4-hydroxybenzoyl-CoA reductase beta subunit

SCOPe Domain Sequences for d1sb3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sb3b1 d.87.2.1 (B:217-323) 4-hydroxybenzoyl-CoA reductase beta subunit HrcB, C-terminal domain {Thauera aromatica [TaxId: 59405]}
awsaayskvrirdavdfplagvaaalqrdgdriaglrvaitgsnsaplmvpvdallggnw
ddaaaetlaqlvrktsnvlrttitgvkyrrrvllaisrkvvdqlwea

SCOPe Domain Coordinates for d1sb3b1 are not available.

Timeline for d1sb3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sb3b2
View in 3D
Domains from other chains:
(mouse over for more information)
d1sb3a1, d1sb3a2, d1sb3c1, d1sb3c2, d1sb3d1, d1sb3d2, d1sb3e1, d1sb3e2, d1sb3f1, d1sb3f2