Lineage for d1sb3e1 (1sb3 E:217-323)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528291Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2528454Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) (S)
    automatically mapped to Pfam PF03450
  5. 2528455Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 protein domains)
  6. 2528456Protein 4-hydroxybenzoyl-CoA reductase beta subunit HrcB, C-terminal domain [118044] (1 species)
  7. 2528457Species Thauera aromatica [TaxId:59405] [118045] (2 PDB entries)
    Uniprot O33820
  8. 2528461Domain d1sb3e1: 1sb3 E:217-323 [112060]
    Other proteins in same PDB: d1sb3a1, d1sb3a2, d1sb3b2, d1sb3c1, d1sb3c2, d1sb3d1, d1sb3d2, d1sb3e2, d1sb3f1, d1sb3f2
    complexed with epe, fad, fes, pcd, sf4, so4

Details for d1sb3e1

PDB Entry: 1sb3 (more details), 2.2 Å

PDB Description: Structure of 4-hydroxybenzoyl-CoA reductase from Thauera aromatica
PDB Compounds: (E:) 4-hydroxybenzoyl-CoA reductase beta subunit

SCOPe Domain Sequences for d1sb3e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sb3e1 d.87.2.1 (E:217-323) 4-hydroxybenzoyl-CoA reductase beta subunit HrcB, C-terminal domain {Thauera aromatica [TaxId: 59405]}
awsaayskvrirdavdfplagvaaalqrdgdriaglrvaitgsnsaplmvpvdallggnw
ddaaaetlaqlvrktsnvlrttitgvkyrrrvllaisrkvvdqlwea

SCOPe Domain Coordinates for d1sb3e1:

Click to download the PDB-style file with coordinates for d1sb3e1.
(The format of our PDB-style files is described here.)

Timeline for d1sb3e1: