Lineage for d1sb3c1 (1sb3 C:82-157)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998451Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 1998452Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 1998453Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 protein domains)
  6. 1998454Protein 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, C-terminal domain [116919] (1 species)
  7. 1998455Species Thauera aromatica [TaxId:59405] [116920] (2 PDB entries)
    Uniprot O33818
  8. 1998458Domain d1sb3c1: 1sb3 C:82-157 [112056]
    Other proteins in same PDB: d1sb3a1, d1sb3a2, d1sb3b1, d1sb3b2, d1sb3c2, d1sb3d1, d1sb3d2, d1sb3e1, d1sb3e2, d1sb3f2
    complexed with epe, fad, fes, pcd, sf4, so4

Details for d1sb3c1

PDB Entry: 1sb3 (more details), 2.2 Å

PDB Description: Structure of 4-hydroxybenzoyl-CoA reductase from Thauera aromatica
PDB Compounds: (C:) 4-hydroxybenzoyl-CoA reductase gamma subunit

SCOPe Domain Sequences for d1sb3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sb3c1 a.56.1.1 (C:82-157) 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, C-terminal domain {Thauera aromatica [TaxId: 59405]}
qgtlsklqaafheklgtqcgfctpgmimaseallrknpspsrdeikaalagnlcrctgyv
kiiksvetaaaarlce

SCOPe Domain Coordinates for d1sb3c1:

Click to download the PDB-style file with coordinates for d1sb3c1.
(The format of our PDB-style files is described here.)

Timeline for d1sb3c1: