PDB entry 1sb3

View 1sb3 on RCSB PDB site
Description: Structure of 4-hydroxybenzoyl-CoA reductase from Thauera aromatica
Class: oxidoreductase
Keywords: XANTHINE OXIDASE FAMILY, dimer of heterotrimers, (A, B, C)2, OXIDOREDUCTASE
Deposited on 2004-02-10, released 2004-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-03-31, with a file datestamp of 2009-03-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.171
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-hydroxybenzoyl-CoA reductase alpha subunit
    Species: Thauera aromatica [TaxId:59405]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33819 (Start-768)
      • see remark 999 (250)
    Domains in SCOPe 2.07: d1sb3a1, d1sb3a2
  • Chain 'B':
    Compound: 4-hydroxybenzoyl-CoA reductase beta subunit
    Species: Thauera aromatica [TaxId:59405]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sb3b1, d1sb3b2
  • Chain 'C':
    Compound: 4-hydroxybenzoyl-CoA reductase gamma subunit
    Species: Thauera aromatica [TaxId:59405]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33818 (0-160)
      • see remark 999 (141-143)
    Domains in SCOPe 2.07: d1sb3c1, d1sb3c2
  • Chain 'D':
    Compound: 4-hydroxybenzoyl-CoA reductase alpha subunit
    Species: Thauera aromatica [TaxId:59405]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33819
      • see remark 999 (250)
    Domains in SCOPe 2.07: d1sb3d1, d1sb3d2
  • Chain 'E':
    Compound: 4-hydroxybenzoyl-CoA reductase beta subunit
    Species: Thauera aromatica [TaxId:59405]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sb3e1, d1sb3e2
  • Chain 'F':
    Compound: 4-hydroxybenzoyl-CoA reductase gamma subunit
    Species: Thauera aromatica [TaxId:59405]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33818 (0-End)
      • see remark 999 (141-143)
    Domains in SCOPe 2.07: d1sb3f1, d1sb3f2
  • Heterogens: SO4, PCD, FAD, SF4, FES, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sb3A (A:)
    mspklpqhgtvgvrtplvdgvekvtgkakytadiaapdalvgrilrsphaharilaidts
    aaealegviavctgaetpvpfgvlpiaeneyplardkvryrgdpvaavaaidevtaekal
    alikvdyevlpaymtpkaamkagaialhddkpnnilrevhaefgdvaaafaeadlirekt
    ytfaevnhvhmelnatlaeydpvrdmltlntttqvpyyvhlkvaaclqmdsarirvikpf
    lgggfgartealhfeiiagllarkakgtvrllqtreetfiahrgrpwtevkmkiglkkdg
    kiaalaleatqaggayagygiitilytgalmhglyhipaikhdawrvytntppcgamrgh
    gtvdtraafealltemgeelgidslkirqinmlpqipyvtmyaqrvmsygvpeclekvka
    asgweerkgklpkgrglgialshfvsgtstpkhwtgephatvnlkldfdggitlltgaad
    igqgsntmasqvaaevlgvrlsrirvisadsaltpkdngsyssrvtfmvgnasisaaeel
    kgvlvkaaakkldareedievidemfmvsgsqdpglsfqevvkaamvdsgtitvkgtytc
    ptefqgdkkirgsaigatmgfcyaaqvveasvdeitgkvtahkvwvavdvgkalnplave
    gqtqggvwmgmgqalseetvydngrmvhgnildyrvptivespdieviivesmdpngpfg
    akeasegmlagflpaiheavyeavgvratdfplspdritelldakeaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sb3A (A:)
    gtvgvrtplvdgvekvtgkakytadiaapdalvgrilrsphaharilaidtsaaealegv
    iavctgaetpvpfgvlpiaeneyplardkvryrgdpvaavaaidevtaekalalikvdye
    vlpaymtpkaamkagaialhddkpnnilrevhaefgdvaaafaeadlirektytfaevnh
    vhmelnatlaeydpvrdmltlntttqvpyyvhlkvaaclqmdsarirvikpflgggfgar
    tealhfeiiagllarkakgtvrllqtreetfiahrgrpwtevkmkiglkkdgkiaalale
    atqaggayagygiitilytgalmhglyhipaikhdawrvytntppcgamrghgtvdtraa
    fealltemgeelgidslkirqinmlpqipyvtmyaqrvmsygvpeclekvkaasgweerk
    gklpkgrglgialshfvsgtstpkhwtgephatvnlkldfdggitlltgaadigqgsntm
    asqvaaevlgvrlsrirvisadsaltpkdngsyssrvtfmvgnasisaaeelkgvlvkaa
    akkldareedievidemfmvsgsqdpglsfqevvkaamvdsgtitvkgtytcptefqgdk
    kirgsaigatmgfcyaaqvveasvdeitgkvtahkvwvavdvgkalnplavegqtqggvw
    mgmgqalseetvydngrmvhgnildyrvptivespdieviivesmdpngpfgakeasegm
    lagflpaiheavyeavgvratdfplspdritelldakeaaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sb3B (B:)
    mniltdfrthrpatladavnalaaeatlplgagtdllpnlrrglghpaalvdltgidgla
    tistladgslrigagatleaiaehdairttwpalaqaaesvagpthraaatlggnlcqdt
    rctfynqsewwrsgngyclkykgdkchvivksdrcyatyhgdvapalmvldaraeivgpa
    gkrtvpvaqlfresgaehltlekgellaaievpptgawsaayskvrirdavdfplagvaa
    alqrdgdriaglrvaitgsnsaplmvpvdallggnwddaaaetlaqlvrktsnvlrttit
    gvkyrrrvllaisrkvvdqlwear
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sb3B (B:)
    mniltdfrthrpatladavnalaaeatlplgagtdllpnlrrglghpaalvdltgidgla
    tistladgslrigagatleaiaehdairttwpalaqaaesvagpthraaatlggnlcqdt
    rctfynqsewwrsgngyclkykgdkchvivksdrcyatyhgdvapalmvldaraeivgpa
    gkrtvpvaqlfresgaehltlekgellaaievpptgawsaayskvrirdavdfplagvaa
    alqrdgdriaglrvaitgsnsaplmvpvdallggnwddaaaetlaqlvrktsnvlrttit
    gvkyrrrvllaisrkvvdqlwea
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sb3C (C:)
    mknilrltlngraredlvpdnmllldylretvgltgtkqgcdggecgactvlvddrprla
    cstlahqvagkkvetveslatqgtlsklqaafheklgtqcgfctpgmimaseallrknps
    psrdeikaalagnlcrctgyvkiiksvetaaaarlceegar
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sb3D (D:)
    mspklpqhgtvgvrtplvdgvekvtgkakytadiaapdalvgrilrsphaharilaidts
    aaealegviavctgaetpvpfgvlpiaeneyplardkvryrgdpvaavaaidevtaekal
    alikvdyevlpaymtpkaamkagaialhddkpnnilrevhaefgdvaaafaeadlirekt
    ytfaevnhvhmelnatlaeydpvrdmltlntttqvpyyvhlkvaaclqmdsarirvikpf
    lgggfgartealhfeiiagllarkakgtvrllqtreetfiahrgrpwtevkmkiglkkdg
    kiaalaleatqaggayagygiitilytgalmhglyhipaikhdawrvytntppcgamrgh
    gtvdtraafealltemgeelgidslkirqinmlpqipyvtmyaqrvmsygvpeclekvka
    asgweerkgklpkgrglgialshfvsgtstpkhwtgephatvnlkldfdggitlltgaad
    igqgsntmasqvaaevlgvrlsrirvisadsaltpkdngsyssrvtfmvgnasisaaeel
    kgvlvkaaakkldareedievidemfmvsgsqdpglsfqevvkaamvdsgtitvkgtytc
    ptefqgdkkirgsaigatmgfcyaaqvveasvdeitgkvtahkvwvavdvgkalnplave
    gqtqggvwmgmgqalseetvydngrmvhgnildyrvptivespdieviivesmdpngpfg
    akeasegmlagflpaiheavyeavgvratdfplspdritelldakeaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sb3D (D:)
    gtvgvrtplvdgvekvtgkakytadiaapdalvgrilrsphaharilaidtsaaealegv
    iavctgaetpvpfgvlpiaeneyplardkvryrgdpvaavaaidevtaekalalikvdye
    vlpaymtpkaamkagaialhddkpnnilrevhaefgdvaaafaeadlirektytfaevnh
    vhmelnatlaeydpvrdmltlntttqvpyyvhlkvaaclqmdsarirvikpflgggfgar
    tealhfeiiagllarkakgtvrllqtreetfiahrgrpwtevkmkiglkkdgkiaalale
    atqaggayagygiitilytgalmhglyhipaikhdawrvytntppcgamrghgtvdtraa
    fealltemgeelgidslkirqinmlpqipyvtmyaqrvmsygvpeclekvkaasgweerk
    gklpkgrglgialshfvsgtstpkhwtgephatvnlkldfdggitlltgaadigqgsntm
    asqvaaevlgvrlsrirvisadsaltpkdngsyssrvtfmvgnasisaaeelkgvlvkaa
    akkldareedievidemfmvsgsqdpglsfqevvkaamvdsgtitvkgtytcptefqgdk
    kirgsaigatmgfcyaaqvveasvdeitgkvtahkvwvavdvgkalnplavegqtqggvw
    mgmgqalseetvydngrmvhgnildyrvptivespdieviivesmdpngpfgakeasegm
    lagflpaiheavyeavgvratdfplspdritelldakeaa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1sb3E (E:)
    mniltdfrthrpatladavnalaaeatlplgagtdllpnlrrglghpaalvdltgidgla
    tistladgslrigagatleaiaehdairttwpalaqaaesvagpthraaatlggnlcqdt
    rctfynqsewwrsgngyclkykgdkchvivksdrcyatyhgdvapalmvldaraeivgpa
    gkrtvpvaqlfresgaehltlekgellaaievpptgawsaayskvrirdavdfplagvaa
    alqrdgdriaglrvaitgsnsaplmvpvdallggnwddaaaetlaqlvrktsnvlrttit
    gvkyrrrvllaisrkvvdqlwear
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sb3E (E:)
    mniltdfrthrpatladavnalaaeatlplgagtdllpnlrrglghpaalvdltgidgla
    tistladgslrigagatleaiaehdairttwpalaqaaesvagpthraaatlggnlcqdt
    rctfynqsewwrsgngyclkykgdkchvivksdrcyatyhgdvapalmvldaraeivgpa
    gkrtvpvaqlfresgaehltlekgellaaievpptgawsaayskvrirdavdfplagvaa
    alqrdgdriaglrvaitgsnsaplmvpvdallggnwddaaaetlaqlvrktsnvlrttit
    gvkyrrrvllaisrkvvdqlwea
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1sb3F (F:)
    mknilrltlngraredlvpdnmllldylretvgltgtkqgcdggecgactvlvddrprla
    cstlahqvagkkvetveslatqgtlsklqaafheklgtqcgfctpgmimaseallrknps
    psrdeikaalagnlcrctgyvkiiksvetaaaarlceegar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sb3F (F:)
    mknilrltlngraredlvpdnmllldylretvgltgtkqgcdggecgactvlvddrprla
    cstlahqvagkkvetveslatqgtlsklqaafheklgtqcgfctpgmimaseallrknps
    psrdeikaalagnlcrctgyvkiiksvetaaaarlce