Lineage for d1sb3b2 (1sb3 B:1-216)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
    automatically mapped to Pfam PF00941
  6. Protein 4-hydroxybenzoyl-CoA reductase beta subunit HrcB, N-terminal domain [118141] (1 species)
  7. Species Thauera aromatica [TaxId:59405] [118142] (2 PDB entries)
    Uniprot O33820
  8. Domain d1sb3b2: 1sb3 B:1-216 [112055]
    Other proteins in same PDB: d1sb3a1, d1sb3a2, d1sb3b1, d1sb3c1, d1sb3c2, d1sb3d1, d1sb3d2, d1sb3e1, d1sb3f1, d1sb3f2
    complexed with epe, fad, fes, pcd, sf4, so4

Details for d1sb3b2

PDB Entry: 1sb3 (more details), 2.2 Å

PDB Description: Structure of 4-hydroxybenzoyl-CoA reductase from Thauera aromatica
PDB Compounds: (B:) 4-hydroxybenzoyl-CoA reductase beta subunit

SCOPe Domain Sequences for d1sb3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sb3b2 d.145.1.3 (B:1-216) 4-hydroxybenzoyl-CoA reductase beta subunit HrcB, N-terminal domain {Thauera aromatica [TaxId: 59405]}
mniltdfrthrpatladavnalaaeatlplgagtdllpnlrrglghpaalvdltgidgla
tistladgslrigagatleaiaehdairttwpalaqaaesvagpthraaatlggnlcqdt
rctfynqsewwrsgngyclkykgdkchvivksdrcyatyhgdvapalmvldaraeivgpa
gkrtvpvaqlfresgaehltlekgellaaievpptg

SCOPe Domain Coordinates for d1sb3b2 are not available.

Timeline for d1sb3b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sb3b1
View in 3D
Domains from other chains:
(mouse over for more information)
d1sb3a1, d1sb3a2, d1sb3c1, d1sb3c2, d1sb3d1, d1sb3d2, d1sb3e1, d1sb3e2, d1sb3f1, d1sb3f2