Lineage for d1uikb1 (1uik B:148-350)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. Protein Seed storage 7S protein [51188] (6 species)
    duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer
  7. Species Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId:3847] [110313] (1 PDB entry)
    Uniprot Q7XXT2 204-621
  8. Domain d1uikb1: 1uik B:148-350 [107880]
    complexed with mg

Details for d1uikb1

PDB Entry: 1uik (more details), 2.3 Å

PDB Description: Crystal structure of soybean beta-conglycinin alpha prime homotrimer
PDB Compounds: (B:) alpha prime subunit of beta-conglycinin

SCOPe Domain Sequences for d1uikb1:

Sequence, based on SEQRES records: (download)

>d1uikb1 b.82.1.2 (B:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]}
npfhfnskrfqtlfknqyghvrvlqrfnkrsqqlqnlrdyrilefnskpntlllphhada
dylivilngtailtlvnnddrdsynlqsgdalrvpagttyyvvnpdndenlrmitlaipv
nkpgrfesfflsstqaqqsylqgfsknileasydtkfeeinkvlfgreegqqqgeerlqe
sviveiskkqirelskhaksssr

Sequence, based on observed residues (ATOM records): (download)

>d1uikb1 b.82.1.2 (B:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]}
npfhfnskrfqtlfknqyghvrvlqrfnkrsqqlqnlrdyrilefnskpntlllphhada
dylivilngtailtlvnnddrdsynlqsgdalrvpagttyyvvnpdndenlrmitlaipv
nkpgrfesfflsstqaqqsylqgfsknileasydtkfeeinkvlfgqesviveiskkqir
elskhaksssr

SCOPe Domain Coordinates for d1uikb1 are not available.

Timeline for d1uikb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uikb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1uika1, d1uika2, d1uikc1, d1uikc2