![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (13 families) ![]() |
![]() | Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins) |
![]() | Protein Seed storage 7S protein [51188] (6 species) duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer |
![]() | Species Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId:3847] [110313] (1 PDB entry) |
![]() | Domain d1uikb1: 1uik B:148-350 [107880] |
PDB Entry: 1uik (more details), 2.3 Å
SCOP Domain Sequences for d1uikb1:
Sequence, based on SEQRES records: (download)
>d1uikb1 b.82.1.2 (B:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit} npfhfnskrfqtlfknqyghvrvlqrfnkrsqqlqnlrdyrilefnskpntlllphhada dylivilngtailtlvnnddrdsynlqsgdalrvpagttyyvvnpdndenlrmitlaipv nkpgrfesfflsstqaqqsylqgfsknileasydtkfeeinkvlfgreegqqqgeerlqe sviveiskkqirelskhaksssr
>d1uikb1 b.82.1.2 (B:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit} npfhfnskrfqtlfknqyghvrvlqrfnkrsqqlqnlrdyrilefnskpntlllphhada dylivilngtailtlvnnddrdsynlqsgdalrvpagttyyvvnpdndenlrmitlaipv nkpgrfesfflsstqaqqsylqgfsknileasydtkfeeinkvlfgqesviveiskkqir elskhaksssr
Timeline for d1uikb1:
![]() Domains from other chains: (mouse over for more information) d1uika1, d1uika2, d1uikc1, d1uikc2 |