Lineage for d1uikc2 (1uik C:351-535)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070015Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2070093Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 protein domains)
  6. 2070117Protein Seed storage 7S protein [51188] (6 species)
    duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer
  7. 2070152Species Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId:3847] [110313] (1 PDB entry)
    Uniprot Q7XXT2 204-621
  8. 2070158Domain d1uikc2: 1uik C:351-535 [107883]
    complexed with mg

Details for d1uikc2

PDB Entry: 1uik (more details), 2.3 Å

PDB Description: Crystal structure of soybean beta-conglycinin alpha prime homotrimer
PDB Compounds: (C:) alpha prime subunit of beta-conglycinin

SCOPe Domain Sequences for d1uikc2:

Sequence, based on SEQRES records: (download)

>d1uikc2 b.82.1.2 (C:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]}
ktissedkpfnlrsrdpiysnklgklfeitpeknpqlrdldvflsvvdmnegalflphfn
skaivvlvinegeanielvgikeqqqrqqqeeqplevrkyraelseqdifvipagypvvv
natsdlnffafginaennqrnflagskdnvisqipsqvqelafpgsakdienliksqses
yfvda

Sequence, based on observed residues (ATOM records): (download)

>d1uikc2 b.82.1.2 (C:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]}
ktissedkpfnlrsrdpiysnklgklfeitpeknpqlrdldvflsvvdmnegalflphfn
skaivvlvinegeanielvgiplevrkyraelseqdifvipagypvvvnatsdlnffafg
inaennqrnflagskdnvisqipsqvqelafpgsakdienliksqsesyfvda

SCOPe Domain Coordinates for d1uikc2:

Click to download the PDB-style file with coordinates for d1uikc2.
(The format of our PDB-style files is described here.)

Timeline for d1uikc2: